Lineage for d1k83a_ (1k83 A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141611Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
  4. 141612Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
  5. 141613Family e.29.1.1: RNA-polymerase beta [64485] (2 proteins)
  6. 141614Protein RBP1 [64486] (1 species)
  7. 141615Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64487] (4 PDB entries)
  8. 141617Domain d1k83a_: 1k83 A: [68275]
    Other proteins in same PDB: d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_

Details for d1k83a_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83a_:

Sequence, based on SEQRES records: (download)

>d1k83a_ e.29.1.1 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae)}
qyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsidrn
lkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelmrq
alaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklvgs
wkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppp
pvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatym
dndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqv
gvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdi
qlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdg
demnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfield
qvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdng
mliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfst
gigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflne
ardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtl
phfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvka
ledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllnt
dhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirrii
qnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrs
rlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntf
hfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlk
svtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraamnd
kdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlkkie
ntmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidp
triytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggltsv
trhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgafdvm
ideesl

Sequence, based on observed residues (ATOM records): (download)

>d1k83a_ e.29.1.1 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae)}
qyssaplrtvkevqfglfspeevraisvakirfpekigglndprlgsidrnlkcqtcqeg
mnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnelmrqalaikdskk
rfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglklvgswkkepelrv
lsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrddltfkladilkan
isletlehngaphhaieeaesllqfhvatymdndiagqsirarlkgkegrivdfsartvi
sgdpnleldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdri
dlryskragdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnls
vtspynadfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirk
ltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfde
gttllspkdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvv
nfwllhngfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlres
fednvvrflneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegk
riafgfvdrtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktae
tgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaaf
ekryrvdllntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgean
wplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrd
avtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsig
epatqmtlkkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttl
ksvtiaseiyydpdprstvipedeeiiqlhfsqqspwllrleldraamndkdltmgqvge
rikqtfkndlfviwsedndekliircrvvaeedhmlkkientmlenitlrgveniervvm
mkydrkvpsptgeyvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieag
raalykevynviasdgsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfee
tveilfeagasaelddcrgvsenvilgqmapigtgafdvmideesl

SCOP Domain Coordinates for d1k83a_:

Click to download the PDB-style file with coordinates for d1k83a_.
(The format of our PDB-style files is described here.)

Timeline for d1k83a_: