Lineage for d1k7ya3 (1k7y A:901-1227)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3003123Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354
  4. 3003124Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families) (S)
  5. 3003125Family d.173.1.1: Methionine synthase SAM-binding domain [56508] (2 proteins)
  6. 3003126Protein Methionine synthase SAM-binding domain [56509] (1 species)
  7. 3003127Species Escherichia coli [TaxId:562] [56510] (5 PDB entries)
  8. 3003131Domain d1k7ya3: 1k7y A:901-1227 [68274]
    Other proteins in same PDB: d1k7ya1, d1k7ya2
    complexed with b12, so4

Details for d1k7ya3

PDB Entry: 1k7y (more details), 3 Å

PDB Description: e. coli meth c-terminal fragment (649-1227)
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1k7ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ya3 d.173.1.1 (A:901-1227) Methionine synthase SAM-binding domain {Escherichia coli [TaxId: 562]}
tppvtleaardndfafdwqaytppvahrlgvqeveasietlrnyidwtpffmtwslagky
priledevvgveaqrlfkdandmldklsaektlnprgvvglfpanrvgddieiyrdetrt
hvinvshhlrqqtektgfanycladfvapklsgkadyigafavtggleedaladafeaqh
ddynkimvkaladrlaeafaeylhervrkvywgyapnenlsneelirenyqgirpapgyp
acpehtekatiwellevekhtgmkltesfamwpgasvsgwyfshpdskyyavaqiqrdqv
edyarrkgmsvteverwlapnlgydad

SCOPe Domain Coordinates for d1k7ya3:

Click to download the PDB-style file with coordinates for d1k7ya3.
(The format of our PDB-style files is described here.)

Timeline for d1k7ya3: