Lineage for d1k7ya2 (1k7y A:741-900)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439787Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) (S)
  5. 2439788Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 protein domains)
  6. 2439805Protein Methionine synthase, C-terminal domain [52244] (1 species)
  7. 2439806Species Escherichia coli [TaxId:562] [52245] (5 PDB entries)
  8. 2439811Domain d1k7ya2: 1k7y A:741-900 [68273]
    Other proteins in same PDB: d1k7ya1, d1k7ya3
    complexed with b12, so4

Details for d1k7ya2

PDB Entry: 1k7y (more details), 3 Å

PDB Description: e. coli meth c-terminal fragment (649-1227)
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1k7ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ya2 c.23.6.1 (A:741-900) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]}
eqgktngkmviatvkgdvgdigknivgvvlqcnnyeivdlgvmvpaekilrtakevnadl
iglsglitpsldemvnvakemerqgftiplliggattskahtavkieqnysgptvyvqna
srtvgvvaallsdtqrddfvartrkeyetvriqhgrkkpr

SCOPe Domain Coordinates for d1k7ya2:

Click to download the PDB-style file with coordinates for d1k7ya2.
(The format of our PDB-style files is described here.)

Timeline for d1k7ya2: