Lineage for d1k7ba1 (1k7b A:11-51)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260002Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2260003Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2260004Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 2260036Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
    the viral-binding domain of Tva
  7. 2260037Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)
  8. 2260038Domain d1k7ba1: 1k7b A:11-51 [68266]
    Other proteins in same PDB: d1k7ba2

Details for d1k7ba1

PDB Entry: 1k7b (more details)

PDB Description: NMR Solution Structure of sTva47, the Viral-Binding Domain of Tva
PDB Compounds: (A:) subgroup a rous sarcoma virus receptor pg800 and pg950

SCOPe Domain Sequences for d1k7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ba1 g.12.1.1 (A:11-51) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
cppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcg

SCOPe Domain Coordinates for d1k7ba1:

Click to download the PDB-style file with coordinates for d1k7ba1.
(The format of our PDB-style files is described here.)

Timeline for d1k7ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7ba2