Lineage for d1k7ba_ (1k7b A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748814Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 748815Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 748816Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 748847Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
    the viral-binding domain of Tva
  7. 748848Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)
  8. 748849Domain d1k7ba_: 1k7b A: [68266]

Details for d1k7ba_

PDB Entry: 1k7b (more details)

PDB Description: nmr solution structure of stva47, the viral-binding domain of tva
PDB Compounds: (A:) subgroup a rous sarcoma virus receptor pg800 and pg950

SCOP Domain Sequences for d1k7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
scppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcg

SCOP Domain Coordinates for d1k7ba_:

Click to download the PDB-style file with coordinates for d1k7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1k7ba_: