SCOPe 2.08: Domain d1k7ba1: 1k7b A:11-51

Lineage for d1k7ba1 (1k7b A:11-51)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
   the viral-binding domain of Tva

7. Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)

8. Domain d1k7ba1: 1k7b A:11-51 [68266]
   Other proteins in same PDB: d1k7ba2

Details for d1k7ba1

PDB Entry: 1k7b

PDB Description: nmr solution structure of stva47, the viral-binding domain of tva

PDB Compounds: (A:) subgroup a rous sarcoma virus receptor pg800 and pg950

SCOPe Domain Sequences for d1k7ba1:

Sequence; same for both SEQRES and ATOM records:

>d1k7ba1 g.12.1.1 (A:11-51) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
cppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcg

Timeline for d1k7ba1:

• d1k7ba1 first appeared in SCOP 1.59, called d1k7ba_
  
• d1k7ba1 appears in SCOPe 2.07