Lineage for d1k79a_ (1k79 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278056Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 278061Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 278065Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)
  8. 278070Domain d1k79a_: 1k79 A: [68262]

Details for d1k79a_

PDB Entry: 1k79 (more details), 2.4 Å

PDB Description: Ets-1(331-440)+GGAA duplex

SCOP Domain Sequences for d1k79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k79a_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

SCOP Domain Coordinates for d1k79a_:

Click to download the PDB-style file with coordinates for d1k79a_.
(The format of our PDB-style files is described here.)

Timeline for d1k79a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k79d_