SCOP 1.65: Domain d1k78b_: 1k78 B:

Lineage for d1k78b_ (1k78 B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (6 proteins)

6. Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46863] (7 PDB entries)

8. Domain d1k78b_: 1k78 B: [68257]
   Other proteins in same PDB: d1k78a1, d1k78a2, d1k78e1, d1k78e2, d1k78i1

Details for d1k78b_

PDB Entry: 1k78, 2.25 Å

PDB Description: Pax5(1-149)+Ets-1(331-440)+DNA

SCOP Domain Sequences for d1k78b_:

Sequence; same for both SEQRES and ATOM records:

>d1k78b_ a.4.5.21 (B:) ETS-1 transcription factor, residues 331-440 {Mouse (Mus musculus)}
iqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrglr
yyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

Timeline for d1k78b_:

• d1k78b_ first appeared in SCOP 1.59
  
• d1k78b_ appears in SCOP 1.63
  
• d1k78b_ appears in SCOP 1.67
  
• d1k78b_ appears in the current release, SCOPe 2.08