Lineage for d1k78a1 (1k78 A:19-81)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258209Family a.4.1.5: Paired domain [46748] (3 proteins)
    duplication: consists of two domains of this fold
  6. 1258214Protein Pax-5 [68962] (1 species)
  7. 1258215Species Human (Homo sapiens) [TaxId:9606] [68963] (2 PDB entries)
  8. 1258216Domain d1k78a1: 1k78 A:19-81 [68255]
    Other proteins in same PDB: d1k78b_, d1k78f_
    protein/DNA complex

Details for d1k78a1

PDB Entry: 1k78 (more details), 2.25 Å

PDB Description: Pax5(1-149)+Ets-1(331-440)+DNA
PDB Compounds: (A:) Paired Box Protein Pax5

SCOPe Domain Sequences for d1k78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k78a1 a.4.1.5 (A:19-81) Pax-5 {Human (Homo sapiens) [TaxId: 9606]}
gvnqlggvfvngrplpdvvrqrivelahqgvrpcdisrqlrvshgcvskilgryyetgsi
kpg

SCOPe Domain Coordinates for d1k78a1:

Click to download the PDB-style file with coordinates for d1k78a1.
(The format of our PDB-style files is described here.)

Timeline for d1k78a1: