SCOPe 2.08: Domain d1k74d_: 1k74 D:

Lineage for d1k74d_ (1k74 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
   Uniprot P37231 232-505

8. Domain d1k74d_: 1k74 D: [68252]
   Other proteins in same PDB: d1k74a_
   heterodimer with RXR-alpha complexed with co-activator peptides
   complexed with 544, 9cr

Details for d1k74d_

PDB Entry: 1k74, 2.3 Å

PDB Description: The 2.3 Angstrom resolution crystal structure of the heterodimer of the human PPARgamma and RXRalpha ligand binding domains respectively bound with GW409544 and 9-cis retinoic acid and co-activator peptides.

PDB Compounds: (D:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1k74d_:

Sequence; same for both SEQRES and ATOM records:

>d1k74d_ a.123.1.1 (D:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiykdly

Timeline for d1k74d_:

• d1k74d_ first appeared in SCOP 1.59
  
• d1k74d_ appears in SCOPe 2.07