Lineage for d1k6za1 (1k6z A:1003-1130)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2562691Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 2562692Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 2562693Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 2562731Protein YopE chaperone SycE [69637] (2 species)
  7. 2562741Species Yersinia pestis [TaxId:632] [69638] (3 PDB entries)
  8. 2562744Domain d1k6za1: 1k6z A:1003-1130 [68247]
    Other proteins in same PDB: d1k6za2, d1k6zb2
    complexed with imd

Details for d1k6za1

PDB Entry: 1k6z (more details), 2 Å

PDB Description: Crystal Structure of the Yersinia Secretion Chaperone SycE
PDB Compounds: (A:) Type III secretion chaperone SycE

SCOPe Domain Sequences for d1k6za1:

Sequence, based on SEQRES records: (download)

>d1k6za1 d.198.1.1 (A:1003-1130) YopE chaperone SycE {Yersinia pestis [TaxId: 632]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnndeket
llshnifsqdilkpilswdevgghpvlwnrqplnsldnnslytqlemlvqgaerlqtssl
ispprsfs

Sequence, based on observed residues (ATOM records): (download)

>d1k6za1 d.198.1.1 (A:1003-1130) YopE chaperone SycE {Yersinia pestis [TaxId: 632]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnndeket
llshnifsqdilkpilswdevgghpvlwnrqplnsldnnslytqlemlvqgaerlqrsfs

SCOPe Domain Coordinates for d1k6za1:

Click to download the PDB-style file with coordinates for d1k6za1.
(The format of our PDB-style files is described here.)

Timeline for d1k6za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k6za2