Lineage for d1k6xa_ (1k6x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842649Protein Negative transcriptional regulator NmrA [69407] (1 species)
    has an UDP-galactose 4-epimerase-like structure but evolved a different function
  7. 2842650Species Emericella nidulans (Aspergillus nidulans) [TaxId:162425] [69408] (6 PDB entries)
    Uniprot O59919
  8. 2842652Domain d1k6xa_: 1k6x A: [68238]
    complexed with cl, nad
    has additional subdomain(s) that are not in the common domain

Details for d1k6xa_

PDB Entry: 1k6x (more details), 1.5 Å

PDB Description: Crystal structure of Nmra, a negative transcriptional regulator in complex with NAD at 1.5 A resolution (Trigonal form)
PDB Compounds: (A:) NmrA

SCOPe Domain Sequences for d1k6xa_:

Sequence, based on SEQRES records: (download)

>d1k6xa_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkgag
agmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml

Sequence, based on observed residues (ATOM records): (download)

>d1k6xa_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]}
qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsggvisqrvtdearklwsgw
rdmeeyarevfpieeeangldwml

SCOPe Domain Coordinates for d1k6xa_:

Click to download the PDB-style file with coordinates for d1k6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1k6xa_: