Lineage for d1k6wa2 (1k6w A:56-375)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442341Family c.1.9.5: Cytosine deaminase catalytic domain [69390] (1 protein)
    automatically mapped to Pfam PF13147
    automatically mapped to Pfam PF07969
  6. 2442342Protein Cytosine deaminase catalytic domain [69391] (1 species)
  7. 2442343Species Escherichia coli [TaxId:562] [69392] (8 PDB entries)
    Uniprot P25524
  8. 2442350Domain d1k6wa2: 1k6w A:56-375 [68237]
    Other proteins in same PDB: d1k6wa1
    complexed with fe

Details for d1k6wa2

PDB Entry: 1k6w (more details), 1.75 Å

PDB Description: The Structure of Escherichia coli Cytosine Deaminase
PDB Compounds: (A:) Cytosine deaminase

SCOPe Domain Sequences for d1k6wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6wa2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]}
pfvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiang
iqhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrl
gadvvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahh
egmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgi
trvkemlesginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlith
hsartlnlqdygiaagnsan

SCOPe Domain Coordinates for d1k6wa2:

Click to download the PDB-style file with coordinates for d1k6wa2.
(The format of our PDB-style files is described here.)

Timeline for d1k6wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k6wa1