SCOP 1.71: Domain d1k6wa2: 1k6w A:56-375

Lineage for d1k6wa2 (1k6w A:56-375)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.5: Cytosine deaminase catalytic domain [69390] (1 protein)

6. Protein Cytosine deaminase catalytic domain [69391] (1 species)

7. Species Escherichia coli [TaxId:562] [69392] (8 PDB entries)

8. Domain d1k6wa2: 1k6w A:56-375 [68237]
   Other proteins in same PDB: d1k6wa1
   complexed with fe

Details for d1k6wa2

PDB Entry: 1k6w, 1.75 Å

PDB Description: The Structure of Escherichia coli Cytosine Deaminase

SCOP Domain Sequences for d1k6wa2:

Sequence; same for both SEQRES and ATOM records:

>d1k6wa2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli}
pfvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiang
iqhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrl
gadvvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahh
egmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgi
trvkemlesginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlith
hsartlnlqdygiaagnsan

Timeline for d1k6wa2:

• d1k6wa2 first appeared in SCOP 1.59
  
• d1k6wa2 appears in SCOP 1.69
  
• d1k6wa2 appears in SCOP 1.73
  
• d1k6wa2 appears in the current release, SCOPe 2.08