Lineage for d1k6wa2 (1k6w A:56-375)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (5 families) 
Family c.1.9.5: Cytosine deaminase catalytic domain [69390] (1 protein) Protein Cytosine deaminase catalytic domain [69391] (1 species) Species Escherichia coli [TaxId:562] [69392] (2 PDB entries) 
Domain d1k6wa2: 1k6w A:56-375 [68237]
Other proteins in same PDB: d1k6wa1
Details for d1k6wa2
PDB Entry: 1k6w (more details), 1.75 Å
PDB Description: The Structure of Escherichia coli Cytosine Deaminase
SCOP Domain Sequences for d1k6wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6wa2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli}
pfvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiang
iqhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrl
gadvvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahh
egmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgi
trvkemlesginvcfghddvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlith
hsartlnlqdygiaagnsan
SCOP Domain Coordinates for d1k6wa2:
Click to download the PDB-style file with coordinates for d1k6wa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k6wa2:
- d1k6wa2 is new in SCOP 1.59
- d1k6wa2 appears in SCOP 1.61
- d1k6wa2 appears in the current release, SCOPe 2.08
View in 3D
