SCOP 1.59: Domain d1k6wa1: 1k6w A:4-55,A:376-426

Lineage for d1k6wa1 (1k6w A:4-55,A:376-426)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (2 families)

5. Family b.92.1.2: Cytosine deaminase [69373] (1 protein)

6. Protein Cytosine deaminase [69374] (1 species)

7. Species Escherichia coli [TaxId:562] [69375] (2 PDB entries)

8. Domain d1k6wa1: 1k6w A:4-55,A:376-426 [68236]
   Other proteins in same PDB: d1k6wa2

Details for d1k6wa1

PDB Entry: 1k6w, 1.75 Å

PDB Description: The Structure of Escherichia coli Cytosine Deaminase

SCOP Domain Sequences for d1k6wa1:

Sequence; same for both SEQRES and ATOM records:

>d1k6wa1 b.92.1.2 (A:4-55,A:376-426) Cytosine deaminase {Escherichia coli}
alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipXliilpae
ngfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr

Timeline for d1k6wa1:

• d1k6wa1 is new in SCOP 1.59
  
• d1k6wa1 appears in SCOP 1.61
  
• d1k6wa1 appears in the current release, SCOPe 2.08