Lineage for d1k6vb_ (1k6v B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 231370Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 231371Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 231372Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 231741Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 231742Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 231744Domain d1k6vb_: 1k6v B: [68235]
    complexed with act, xn2; mutant

Details for d1k6vb_

PDB Entry: 1k6v (more details), 2 Å

PDB Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease

SCOP Domain Sequences for d1k6vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6vb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptptnvigrnlltqigctlnf

SCOP Domain Coordinates for d1k6vb_:

Click to download the PDB-style file with coordinates for d1k6vb_.
(The format of our PDB-style files is described here.)

Timeline for d1k6vb_: