Class b: All beta proteins [48724] (119 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species) |
Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries) |
Domain d1k6vb_: 1k6v B: [68235] complexed with act, xn2; mutant |
PDB Entry: 1k6v (more details), 2 Å
SCOP Domain Sequences for d1k6vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6vb_ b.50.1.1 (B:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptptnvigrnlltqigctlnf
Timeline for d1k6vb_: