| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
| Family d.88.1.1: SRF-like [55456] (4 proteins) |
| Protein Serum response factor (SRF) core [55457] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries) |
| Domain d1k6oc_: 1k6o C: [68228] Other proteins in same PDB: d1k6oa_ |
PDB Entry: 1k6o (more details), 3.19 Å
SCOP Domain Sequences for d1k6oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6oc_ d.88.1.1 (C:) Serum response factor (SRF) core {Human (Homo sapiens)}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclns
Timeline for d1k6oc_: