Lineage for d1k62b_ (1k62 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010279Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 2010319Species Human (Homo sapiens) [TaxId:9606] [48565] (2 PDB entries)
  8. 2010321Domain d1k62b_: 1k62 B: [68214]
    mutant

Details for d1k62b_

PDB Entry: 1k62 (more details), 2.65 Å

PDB Description: Crystal Structure of the Human Argininosuccinate Lyase Q286R Mutant
PDB Compounds: (B:) Argininosuccinate Lyase

SCOPe Domain Sequences for d1k62b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k62b_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens) [TaxId: 9606]}
gklwggrfvgavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilh
gldkvaeewaqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwm
rqtcstlsgllwelirtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdse
rllevrkrinvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfw
rslcmthlsrmaedlilyctkefsfvqlsdaystgsslmprkknpdslelirskagrvfg
rcagllmtlkglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqals
pdmlatdlayylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvi
cvwdyrhsveqygalggtarssvdwqirqvrallqaqqa

SCOPe Domain Coordinates for d1k62b_:

Click to download the PDB-style file with coordinates for d1k62b_.
(The format of our PDB-style files is described here.)

Timeline for d1k62b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k62a_