Lineage for d1k62a_ (1k62 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101198Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 101199Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 101200Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 101214Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 101230Species Human (Homo sapiens) [TaxId:9606] [48565] (2 PDB entries)
  8. 101231Domain d1k62a_: 1k62 A: [68213]

Details for d1k62a_

PDB Entry: 1k62 (more details), 2.65 Å

PDB Description: crystal structure of the human argininosuccinate lyase q286r mutant

SCOP Domain Sequences for d1k62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k62a_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Human (Homo sapiens)}
gavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeew
aqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsg
llwelirtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkri
nvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthls
rmaedlilyctkefsfvqlsdaystgsslmprkknpdslelirskagrvfgrcagllmtl
kglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdla
yylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsv
eqygalggtarssvdwqirqvrallqaqqa

SCOP Domain Coordinates for d1k62a_:

Click to download the PDB-style file with coordinates for d1k62a_.
(The format of our PDB-style files is described here.)

Timeline for d1k62a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k62b_