Class b: All beta proteins [48724] (174 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein Synaptogamin I [49576] (2 species) duplication: contains tandem repeat of two similar domains |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries) Uniprot P21707 271-419 ! Uniprot P21707 271-419 |
Domain d1k5wa_: 1k5w A: [68212] second C2 domain complexed with ca |
PDB Entry: 1k5w (more details)
SCOPe Domain Sequences for d1k5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5wa_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]} klgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkkttik kntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhws dmlanprrpiaqwhtlqveeevdamlav
Timeline for d1k5wa_: