![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptogamin I [49576] (1 species) duplication: contains tandem repeat of two similar domains |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries) |
![]() | Domain d1k5wa_: 1k5w A: [68212] second C2 domain complexed with ca |
PDB Entry: 1k5w (more details)
SCOP Domain Sequences for d1k5wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5wa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} klgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkkttik kntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhws dmlanprrpiaqwhtlqveeevdamlav
Timeline for d1k5wa_: