SCOP 1.71: Domain d1k5wa_: 1k5w A:

Lineage for d1k5wa_ (1k5w A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.7: C2 domain-like [49561] (4 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (1 species)
   duplication: contains tandem repeat of two similar domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)

8. Domain d1k5wa_: 1k5w A: [68212]
   second C2 domain
   complexed with ca

Details for d1k5wa_

PDB Entry: 1k5w

PDB Description: three-dimensional structure of the synaptotagmin 1 c2b-domain: synaptotagmin 1 as a phospholipid binding machine

SCOP Domain Sequences for d1k5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1k5wa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus)}
klgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkkttik
kntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhws
dmlanprrpiaqwhtlqveeevdamlav

Timeline for d1k5wa_:

• d1k5wa_ first appeared in SCOP 1.59
  
• d1k5wa_ appears in SCOP 1.69
  
• d1k5wa_ appears in SCOP 1.73
  
• d1k5wa_ appears in the current release, SCOPe 2.08