Lineage for d1k5wa_ (1k5w A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107130Fold b.7: C2 domain-like [49561] (4 superfamilies)
  4. 107131Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
  5. 107182Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (4 proteins)
  6. 107193Protein Synaptogamin I [49576] (1 species)
  7. 107194Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (4 PDB entries)
  8. 107197Domain d1k5wa_: 1k5w A: [68212]

Details for d1k5wa_

PDB Entry: 1k5w (more details)

PDB Description: three-dimensional structure of the synaptotagmin 1 c2b-domain: synaptotagmin 1 as a phospholipid binding machine

SCOP Domain Sequences for d1k5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5wa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus)}
klgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkkttik
kntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhws
dmlanprrpiaqwhtlqveeevdamlav

SCOP Domain Coordinates for d1k5wa_:

Click to download the PDB-style file with coordinates for d1k5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1k5wa_: