Lineage for d1k5ua_ (1k5u A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111052Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 111053Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 111054Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 111068Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)
  8. 111089Domain d1k5ua_: 1k5u A: [68207]

Details for d1k5ua_

PDB Entry: 1k5u (more details), 2 Å

PDB Description: Human acidic fibroblast growth factor. 141 amino acid form with amino terminal His tag with His93 replaced by Gly (H93G).

SCOP Domain Sequences for d1k5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5ua_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleengyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

SCOP Domain Coordinates for d1k5ua_:

Click to download the PDB-style file with coordinates for d1k5ua_.
(The format of our PDB-style files is described here.)

Timeline for d1k5ua_: