SCOP 1.63: Domain d1k5je_: 1k5j E:

Lineage for d1k5je_ (1k5j E:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.13.3: Nucleoplasmin core [69203] (1 family)
   oligomerises into a pentameric ring structure

5. Family b.13.3.1: Nucleoplasmin core [69204] (1 protein)

6. Protein Nucleoplasmin core [69205] (1 species)

7. Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry)

8. Domain d1k5je_: 1k5j E: [68205]
   mutant

Details for d1k5je_

PDB Entry: 1k5j, 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core

SCOP Domain Sequences for d1k5je_:

Sequence, based on SEQRES records:

>d1k5je_ b.13.3.1 (E:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaek
svpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhva

Sequence, based on observed residues (ATOM records):

>d1k5je_ b.13.3.1 (E:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeksvpiatlkpsil
pmatmvgieltppvtfrlkagsgplyisgqhva

Timeline for d1k5je_:

• d1k5je_ first appeared in SCOP 1.59
  
• d1k5je_ appears in SCOP 1.61
  
• d1k5je_ appears in SCOP 1.65
  
• d1k5je_ appears in the current release, SCOPe 2.08