Lineage for d1k5je_ (1k5j E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 107845Fold b.13: Nucleoplasmin/PNGase F-like [49741] (3 superfamilies)
  4. 107895Superfamily b.13.3: Nucleoplasmin core [69203] (1 family) (S)
  5. 107896Family b.13.3.1: Nucleoplasmin core [69204] (1 protein)
  6. 107897Protein Nucleoplasmin core [69205] (1 species)
  7. 107898Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry)
  8. 107903Domain d1k5je_: 1k5j E: [68205]

Details for d1k5je_

PDB Entry: 1k5j (more details), 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core

SCOP Domain Sequences for d1k5je_:

Sequence, based on SEQRES records: (download)

>d1k5je_ b.13.3.1 (E:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaek
svpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhva

Sequence, based on observed residues (ATOM records): (download)

>d1k5je_ b.13.3.1 (E:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeksvpiatlkpsil
pmatmvgieltppvtfrlkagsgplyisgqhva

SCOP Domain Coordinates for d1k5je_:

Click to download the PDB-style file with coordinates for d1k5je_.
(The format of our PDB-style files is described here.)

Timeline for d1k5je_: