Lineage for d1k5je_ (1k5j E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821688Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 2821689Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 2821719Protein Nucleoplasmin core [69205] (1 species)
  7. 2821720Species African clawed frog (Xenopus laevis) [TaxId:8355] [69206] (1 PDB entry)
  8. 2821725Domain d1k5je_: 1k5j E: [68205]

Details for d1k5je_

PDB Entry: 1k5j (more details), 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core
PDB Compounds: (E:) Nucleoplasmin Core

SCOPe Domain Sequences for d1k5je_:

Sequence, based on SEQRES records: (download)

>d1k5je_ b.121.3.1 (E:) Nucleoplasmin core {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaek
svpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhva

Sequence, based on observed residues (ATOM records): (download)

>d1k5je_ b.121.3.1 (E:) Nucleoplasmin core {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeksvpiatlkpsil
pmatmvgieltppvtfrlkagsgplyisgqhva

SCOPe Domain Coordinates for d1k5je_:

Click to download the PDB-style file with coordinates for d1k5je_.
(The format of our PDB-style files is described here.)

Timeline for d1k5je_: