SCOP 1.71: Domain d1k5jd_: 1k5j D:

Lineage for d1k5jd_ (1k5j D:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family)
   oligomerizes into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins)

6. Protein Nucleoplasmin core [69205] (1 species)

7. Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry)

8. Domain d1k5jd_: 1k5j D: [68204]

Details for d1k5jd_

PDB Entry: 1k5j, 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core

SCOP Domain Sequences for d1k5jd_:

Sequence, based on SEQRES records:

>d1k5jd_ b.121.3.1 (D:) Nucleoplasmin core {Xenopus laevis}
sliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaeks
vpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhv

Sequence, based on observed residues (ATOM records):

>d1k5jd_ b.121.3.1 (D:) Nucleoplasmin core {Xenopus laevis}
sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivteksvpiatlkpsilpm
atmvgieltppvtfrlkagsgplyisgqhv

Timeline for d1k5jd_:

• d1k5jd_ first appeared in SCOP 1.59
  
• d1k5jd_ appears in SCOP 1.69
  
• d1k5jd_ appears in SCOP 1.73
  
• d1k5jd_ appears in the current release, SCOPe 2.08