Lineage for d1k5jc_ (1k5j C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812356Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 1812357Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 1812387Protein Nucleoplasmin core [69205] (1 species)
  7. 1812388Species African clawed frog (Xenopus laevis) [TaxId:8355] [69206] (1 PDB entry)
  8. 1812391Domain d1k5jc_: 1k5j C: [68203]

Details for d1k5jc_

PDB Entry: 1k5j (more details), 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core
PDB Compounds: (C:) Nucleoplasmin Core

SCOPe Domain Sequences for d1k5jc_:

Sequence, based on SEQRES records: (download)

>d1k5jc_ b.121.3.1 (C:) Nucleoplasmin core {African clawed frog (Xenopus laevis) [TaxId: 8355]}
sliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaeks
vpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhv

Sequence, based on observed residues (ATOM records): (download)

>d1k5jc_ b.121.3.1 (C:) Nucleoplasmin core {African clawed frog (Xenopus laevis) [TaxId: 8355]}
sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtksvpiatlkpsilpma
tmvgieltppvtfrlkagsgplyisgqhv

SCOPe Domain Coordinates for d1k5jc_:

Click to download the PDB-style file with coordinates for d1k5jc_.
(The format of our PDB-style files is described here.)

Timeline for d1k5jc_: