Class b: All beta proteins [48724] (149 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (3 proteins) |
Protein Nucleoplasmin core [69205] (1 species) |
Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry) |
Domain d1k5jc_: 1k5j C: [68203] |
PDB Entry: 1k5j (more details), 2.3 Å
SCOP Domain Sequences for d1k5jc_:
Sequence, based on SEQRES records: (download)
>d1k5jc_ b.121.3.1 (C:) Nucleoplasmin core {Xenopus laevis} sliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaeks vpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhv
>d1k5jc_ b.121.3.1 (C:) Nucleoplasmin core {Xenopus laevis} sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtksvpiatlkpsilpma tmvgieltppvtfrlkagsgplyisgqhv
Timeline for d1k5jc_:
View in 3D Domains from other chains: (mouse over for more information) d1k5ja_, d1k5jb_, d1k5jd_, d1k5je_ |