![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family) ![]() oligomerizes into a pentameric ring structure |
![]() | Family b.121.3.1: Nucleoplasmin-like core domain [69204] (2 proteins) |
![]() | Protein Nucleoplasmin core [69205] (1 species) |
![]() | Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry) |
![]() | Domain d1k5jb_: 1k5j B: [68202] |
PDB Entry: 1k5j (more details), 2.3 Å
SCOP Domain Sequences for d1k5jb_:
Sequence, based on SEQRES records: (download)
>d1k5jb_ b.121.3.1 (B:) Nucleoplasmin core {Xenopus laevis} sliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaeks vpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhva
>d1k5jb_ b.121.3.1 (B:) Nucleoplasmin core {Xenopus laevis} sliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeegaeksvpiatlkp silpmatmvgieltppvtfrlkagsgplyisgqhva
Timeline for d1k5jb_:
![]() Domains from other chains: (mouse over for more information) d1k5ja_, d1k5jc_, d1k5jd_, d1k5je_ |