SCOP 1.65: Domain d1k5ja_: 1k5j A:

Lineage for d1k5ja_ (1k5j A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (1 family)
   oligomerises into a pentameric ring structure

5. Family b.121.3.1: Nucleoplasmin-like core domain [69204] (2 proteins)

6. Protein Nucleoplasmin core [69205] (1 species)

7. Species Xenopus laevis [TaxId:8355] [69206] (1 PDB entry)

8. Domain d1k5ja_: 1k5j A: [68201]

Details for d1k5ja_

PDB Entry: 1k5j, 2.3 Å

PDB Description: the crystal structure of nucleoplasmin-core

SCOP Domain Sequences for d1k5ja_:

Sequence, based on SEQRES records:

>d1k5ja_ b.121.3.1 (A:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivtqeegaek
svpiatlkpsilpmatmvgieltppvtfrlkagsgplyisgqhva

Sequence, based on observed residues (ATOM records):

>d1k5ja_ b.121.3.1 (A:) Nucleoplasmin core {Xenopus laevis}
vsliwgcelneqnktfefkehqlalrtvclgdkakdefhiveivtqeeksvpiatlkpsi
lpmatmvgieltppvtfrlkagsgplyisgqhva

Timeline for d1k5ja_:

• d1k5ja_ first appeared in SCOP 1.59
  
• d1k5ja_ appears in SCOP 1.63
  
• d1k5ja_ appears in SCOP 1.67
  
• d1k5ja_ appears in the current release, SCOPe 2.08