Lineage for d1k5hc3 (1k5h C:126-274)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568239Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2568240Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2568642Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2568643Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 2568644Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
    Uniprot P45568
  8. 2568658Domain d1k5hc3: 1k5h C:126-274 [68200]
    Other proteins in same PDB: d1k5ha1, d1k5ha2, d1k5hb1, d1k5hb2, d1k5hc1, d1k5hc2

Details for d1k5hc3

PDB Entry: 1k5h (more details), 2.5 Å

PDB Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
PDB Compounds: (C:) 1-deoxy-D-xylulose-5-phosphate reductoisomerase

SCOPe Domain Sequences for d1k5hc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5hc3 d.81.1.3 (C:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

SCOPe Domain Coordinates for d1k5hc3:

Click to download the PDB-style file with coordinates for d1k5hc3.
(The format of our PDB-style files is described here.)

Timeline for d1k5hc3: