Lineage for d1k5hb3 (1k5h B:126-274)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135178Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (3 proteins)
  6. 135179Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (1 species)
  7. 135180Species Escherichia coli [TaxId:562] [69771] (1 PDB entry)
  8. 135182Domain d1k5hb3: 1k5h B:126-274 [68197]
    Other proteins in same PDB: d1k5ha1, d1k5ha2, d1k5hb1, d1k5hb2, d1k5hc1, d1k5hc2

Details for d1k5hb3

PDB Entry: 1k5h (more details), 2.5 Å

PDB Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

SCOP Domain Sequences for d1k5hb3:

Sequence, based on SEQRES records: (download)

>d1k5hb3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

Sequence, based on observed residues (ATOM records): (download)

>d1k5hb3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnrkisvdsatmmnkgleyiearwlfnasasqmevl
ihpqsvihsmvryqdgsvlaqlgep

SCOP Domain Coordinates for d1k5hb3:

Click to download the PDB-style file with coordinates for d1k5hb3.
(The format of our PDB-style files is described here.)

Timeline for d1k5hb3: