Lineage for d1k5hb2 (1k5h B:1-125,B:275-300)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2451892Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 2451893Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
    Uniprot P45568
  8. 2451910Domain d1k5hb2: 1k5h B:1-125,B:275-300 [68196]
    Other proteins in same PDB: d1k5ha1, d1k5ha3, d1k5hb1, d1k5hb3, d1k5hc1, d1k5hc3

Details for d1k5hb2

PDB Entry: 1k5h (more details), 2.5 Å

PDB Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
PDB Compounds: (B:) 1-deoxy-D-xylulose-5-phosphate reductoisomerase

SCOPe Domain Sequences for d1k5hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5hb2 c.2.1.3 (B:1-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOPe Domain Coordinates for d1k5hb2:

Click to download the PDB-style file with coordinates for d1k5hb2.
(The format of our PDB-style files is described here.)

Timeline for d1k5hb2: