Lineage for d1k5hb1 (1k5h B:301-396)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99041Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 99115Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 99116Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 99117Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (1 species)
  7. 99118Species Escherichia coli [TaxId:562] [69058] (1 PDB entry)
  8. 99120Domain d1k5hb1: 1k5h B:301-396 [68195]
    Other proteins in same PDB: d1k5ha2, d1k5ha3, d1k5hb2, d1k5hb3, d1k5hc2, d1k5hc3

Details for d1k5hb1

PDB Entry: 1k5h (more details), 2.5 Å

PDB Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

SCOP Domain Sequences for d1k5hb1:

Sequence, based on SEQRES records: (download)

>d1k5hb1 a.69.3.1 (B:301-396) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrl

Sequence, based on observed residues (ATOM records): (download)

>d1k5hb1 a.69.3.1 (B:301-396) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdrepqcvddvlsvdanarevarkevmrl

SCOP Domain Coordinates for d1k5hb1:

Click to download the PDB-style file with coordinates for d1k5hb1.
(The format of our PDB-style files is described here.)

Timeline for d1k5hb1: