Lineage for d1k5ha2 (1k5h A:1-125,A:275-300)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118410Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (1 species)
  7. 118411Species Escherichia coli [TaxId:562] [69411] (1 PDB entry)
  8. 118412Domain d1k5ha2: 1k5h A:1-125,A:275-300 [68193]
    Other proteins in same PDB: d1k5ha1, d1k5ha3, d1k5hb1, d1k5hb3, d1k5hc1, d1k5hc3

Details for d1k5ha2

PDB Entry: 1k5h (more details), 2.5 Å

PDB Description: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

SCOP Domain Sequences for d1k5ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5ha2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOP Domain Coordinates for d1k5ha2:

Click to download the PDB-style file with coordinates for d1k5ha2.
(The format of our PDB-style files is described here.)

Timeline for d1k5ha2: