Lineage for d1k5gb_ (1k5g B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300574Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 300575Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 300680Family b.55.1.3: Ran-binding domain [50764] (2 proteins)
  6. 300685Protein Ran-binding protein 1, Ranbp1 [69292] (1 species)
  7. 300686Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries)
  8. 300691Domain d1k5gb_: 1k5g B: [68181]
    Other proteins in same PDB: d1k5ga_, d1k5gc_, d1k5gd_, d1k5gf_, d1k5gg_, d1k5gi_, d1k5gj_, d1k5gl_

Details for d1k5gb_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5gb_ b.55.1.3 (B:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens)}
nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
flnaenaqkfktkfeecrkeieerek

SCOP Domain Coordinates for d1k5gb_:

Click to download the PDB-style file with coordinates for d1k5gb_.
(The format of our PDB-style files is described here.)

Timeline for d1k5gb_: