Lineage for d1k5ga_ (1k5g A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313766Protein Ran [52609] (2 species)
  7. 313780Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)
  8. 313791Domain d1k5ga_: 1k5g A: [68180]
    Other proteins in same PDB: d1k5gb_, d1k5gc_, d1k5ge_, d1k5gf_, d1k5gh_, d1k5gi_, d1k5gk_, d1k5gl_

Details for d1k5ga_

PDB Entry: 1k5g (more details), 3.1 Å

PDB Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5ga_ c.37.1.8 (A:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpded

SCOP Domain Coordinates for d1k5ga_:

Click to download the PDB-style file with coordinates for d1k5ga_.
(The format of our PDB-style files is described here.)

Timeline for d1k5ga_: