| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) ![]() regular structure consisting of similar repeats |
| Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein) this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain |
| Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species) GTPase-activating protein for SpI1, ortologue of Ran duplication: consists of 11 repeats |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries) |
| Domain d1k5dl_: 1k5d L: [68179] Other proteins in same PDB: d1k5da_, d1k5db_, d1k5dd_, d1k5de_, d1k5dg_, d1k5dh_, d1k5dj_, d1k5dk_ complexed with gnp, mg |
PDB Entry: 1k5d (more details), 2.7 Å
SCOPe Domain Sequences for d1k5dl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5dl_ c.10.1.2 (L:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
Timeline for d1k5dl_: