SCOP 1.61: Domain d1k5dh_: 1k5d H:

Lineage for d1k5dh_ (1k5d H:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)

4. Superfamily b.55.1: PH domain-like [50729] (5 families)

5. Family b.55.1.3: Ran-binding domain [50764] (2 proteins)

6. Protein Ran-binding protein 1, Ranbp1 [69292] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries)

8. Domain d1k5dh_: 1k5d H: [68175]
   Other proteins in same PDB: d1k5da_, d1k5dc_, d1k5dd_, d1k5df_, d1k5dg_, d1k5di_, d1k5dj_, d1k5dl_

Details for d1k5dh_

PDB Entry: 1k5d, 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5dh_:

Sequence; same for both SEQRES and ATOM records:

>d1k5dh_ b.55.1.3 (H:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens)}
nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
flnaenaqkfktkfeecrkeieerek

Timeline for d1k5dh_:

• d1k5dh_ first appeared in SCOP 1.59
  
• d1k5dh_ appears in SCOP 1.63
  
• d1k5dh_ appears in the current release, SCOPe 2.08