Lineage for d1k5de_ (1k5d E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378292Family b.55.1.3: Ran-binding domain [50764] (2 proteins)
  6. 378297Protein Ran-binding protein 1, Ranbp1 [69292] (1 species)
  7. 378298Species Human (Homo sapiens) [TaxId:9606] [69293] (2 PDB entries)
  8. 378300Domain d1k5de_: 1k5d E: [68172]
    Other proteins in same PDB: d1k5da_, d1k5dc_, d1k5dd_, d1k5df_, d1k5dg_, d1k5di_, d1k5dj_, d1k5dl_

Details for d1k5de_

PDB Entry: 1k5d (more details), 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5de_ b.55.1.3 (E:) Ran-binding protein 1, Ranbp1 {Human (Homo sapiens)}
nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
flnaenaqkfktkfeecrkeieerek

SCOP Domain Coordinates for d1k5de_:

Click to download the PDB-style file with coordinates for d1k5de_.
(The format of our PDB-style files is described here.)

Timeline for d1k5de_: