Lineage for d1k5dc_ (1k5d C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390006Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 390007Superfamily c.10.1: RNI-like [52047] (3 families) (S)
    regular structure consisting of similar repeats
  5. 390021Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 390022Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
    GTPase-activating protein for SpI1, ortologue of Ran
    duplication: consists of 11 repeats
  7. 390023Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (3 PDB entries)
  8. 390026Domain d1k5dc_: 1k5d C: [68170]
    Other proteins in same PDB: d1k5da_, d1k5db_, d1k5dd_, d1k5de_, d1k5dg_, d1k5dh_, d1k5dj_, d1k5dk_

Details for d1k5dc_

PDB Entry: 1k5d (more details), 2.7 Å

PDB Description: Crystal structure of Ran-GPPNHP-RanBP1-RanGAP complex

SCOP Domain Sequences for d1k5dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5dc_ c.10.1.2 (C:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe)}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee

SCOP Domain Coordinates for d1k5dc_:

Click to download the PDB-style file with coordinates for d1k5dc_.
(The format of our PDB-style files is described here.)

Timeline for d1k5dc_: