Lineage for d1k53b_ (1k53 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403793Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1403794Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1403795Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 1403796Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 1403812Domain d1k53b_: 1k53 B: [68151]
    b1 domain
    complexed with zn; mutant

Details for d1k53b_

PDB Entry: 1k53 (more details), 2.1 Å

PDB Description: Monomeric Protein L B1 Domain with a G15A Mutation
PDB Compounds: (B:) protein l

SCOPe Domain Sequences for d1k53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k53b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva
dkgytlnikfag

SCOPe Domain Coordinates for d1k53b_:

Click to download the PDB-style file with coordinates for d1k53b_.
(The format of our PDB-style files is described here.)

Timeline for d1k53b_: