Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries) |
Domain d1k53b_: 1k53 B: [68151] b1 domain complexed with zn; mutant |
PDB Entry: 1k53 (more details), 2.1 Å
SCOP Domain Sequences for d1k53b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k53b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus} mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva dkgytlnikfag
Timeline for d1k53b_: