Lineage for d1k53b_ (1k53 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325906Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 325907Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 325923Domain d1k53b_: 1k53 B: [68151]
    b1 domain
    complexed with zn; mutant

Details for d1k53b_

PDB Entry: 1k53 (more details), 2.1 Å

PDB Description: Monomeric Protein L B1 Domain with a G15A Mutation
PDB Compounds: (B:)

SCOP Domain Sequences for d1k53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k53b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
mhhhhhhameevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdva
dkgytlnikfag

SCOP Domain Coordinates for d1k53b_:

Click to download the PDB-style file with coordinates for d1k53b_.
(The format of our PDB-style files is described here.)

Timeline for d1k53b_: