SCOPe 2.06: Domain d1k53a1: 1k53 A:2-64

Lineage for d1k53a1 (1k53 A:2-64)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1k53a1: 1k53 A:2-64 [68150]
   Other proteins in same PDB: d1k53a2, d1k53b2
   b1 domain
   complexed with zn; mutant

Details for d1k53a1

PDB Entry: 1k53, 2.1 Å

PDB Description: monomeric protein l b1 domain with a g15a mutation

PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d1k53a1:

Sequence; same for both SEQRES and ATOM records:

>d1k53a1 d.15.7.1 (A:2-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
eevtikanlifanastqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag

Timeline for d1k53a1:

• d1k53a1 first appeared in SCOP 1.59, called d1k53a_
  
• d1k53a1 was called d1k53a_ in SCOPe 2.05
  
• d1k53a1 appears in SCOPe 2.07
  
• d1k53a1 appears in the current release, SCOPe 2.08