Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries) |
Domain d1k52b1: 1k52 B:2-64 [68149] Other proteins in same PDB: d1k52a2, d1k52b2 b1 domain complexed with zn; mutant |
PDB Entry: 1k52 (more details), 1.8 Å
SCOPe Domain Sequences for d1k52b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k52b1 d.15.7.1 (B:2-64) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]} eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadggytlnik fag
Timeline for d1k52b1: