Lineage for d1k52b_ (1k52 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639450Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 1639451Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 1639458Domain d1k52b_: 1k52 B: [68149]
    b1 domain
    complexed with zn; mutant

Details for d1k52b_

PDB Entry: 1k52 (more details), 1.8 Å

PDB Description: monomeric protein l b1 domain with a k54g mutation
PDB Compounds: (B:) protein l

SCOPe Domain Sequences for d1k52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k52b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dggytlnikfag

SCOPe Domain Coordinates for d1k52b_:

Click to download the PDB-style file with coordinates for d1k52b_.
(The format of our PDB-style files is described here.)

Timeline for d1k52b_: