Lineage for d1k52a_ (1k52 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325906Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 325907Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 325913Domain d1k52a_: 1k52 A: [68148]

Details for d1k52a_

PDB Entry: 1k52 (more details), 1.8 Å

PDB Description: Monomeric Protein L B1 Domain with a K54G mutation
PDB Compounds: (A:)

SCOP Domain Sequences for d1k52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k52a_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
dggytlnikfag

SCOP Domain Coordinates for d1k52a_:

Click to download the PDB-style file with coordinates for d1k52a_.
(The format of our PDB-style files is described here.)

Timeline for d1k52a_: